PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr024975.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 257aa    MW: 29851.3 Da    PI: 5.3148
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr024975.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT  Ed++l+d+v+++G g+W++ +r+ g++R++k+c++rw++yl
      Pbr024975.1 14 RGFWTDAEDQILLDYVREHGEGRWEKLSRETGLKRCGKSCRLRWLNYL 61
                     799*******************************************97 PP

2Myb_DNA-binding55.81.1e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T+eE+el+++++k+lG++ W++Ia +++ gRt++++k++w++ 
      Pbr024975.1  67 RGNITQEEEELIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSI 111
                      7999******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.758961IPR017930Myb domain
SuperFamilySSF466899.71E-3012108IPR009057Homeodomain-like
SMARTSM007176.8E-151363IPR001005SANT/Myb domain
PfamPF002494.0E-151461IPR001005SANT/Myb domain
CDDcd001673.97E-111761No hitNo description
Gene3DG3DSA:1.10.10.603.7E-231768IPR009057Homeodomain-like
PROSITE profilePS5129426.9562116IPR017930Myb domain
SMARTSM007174.6E-1766114IPR001005SANT/Myb domain
PfamPF002491.3E-1567111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-2669115IPR009057Homeodomain-like
CDDcd001673.25E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MGRSSRCEKD GLRRGFWTDA EDQILLDYVR EHGEGRWEKL SRETGLKRCG KSCRLRWLNY  60
LRPDIKRGNI TQEEEELIIR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNS ILRKKAKENQ  120
SERSRNERKT IEDLATEAAS SVETDSHFTK EERRPTNNGI EEKNTEAEPD CHDGFLPNTS  180
DSDMPRNFIT DLNEGQLSIS EFLHTDFTKL CELNMKIVDC TNNCRNGSLM SIPTTEAPLH  240
LEELLNDWEA YDFYLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8285436e-87FR828543.1 Rosa rugosa mRNA for putative MYB transcription factor (myb10 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009334744.10.0PREDICTED: transcription factor WER-like
TrEMBLM5Y7Z71e-125M5Y7Z7_PRUPE; Uncharacterized protein
STRINGVIT_11s0016g01300.t012e-70(Vitis vinifera)
STRINGPOPTR_0006s23810.11e-70(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.14e-58myb domain protein 3